Details of the Target
General Information of Target
| Target ID | LDTP18725 | |||||
|---|---|---|---|---|---|---|
| Target Name | Uncharacterized protein C1orf226 (C1orf226) |
|
||||
| Gene Name | C1orf226 | |||||
| Gene ID | 400793 | |||||
| Synonyms |
Uncharacterized protein C1orf226 |
|||||
| 3D Structure | ||||||
| Sequence |
MKIAEEPSPSLGQTLEWLRKELSEMQIQDQSLLLTLRHLHSVLEELRADSAHWEDARSSG
GTSPIRARAGSEGRGCQPVCSRGLAQLLRGEDSRRSSLP |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K61(10.00) | LDD0277 | [1] | |