Details of the Target
General Information of Target
| Target ID | LDTP18663 | |||||
|---|---|---|---|---|---|---|
| Target Name | Methyl-CpG-binding domain protein 3-like 2B (MBD3L2B) | |||||
| Gene Name | MBD3L2B | |||||
| Synonyms |
Methyl-CpG-binding domain protein 3-like 2B |
|||||
| 3D Structure | ||||||
| Sequence |
MELPYTNLEMAFILLAFVIFSLFTLASIYTTPDDSNEEEEHEKKGREKKRKKSEKKKNCS
EEEHRIEAVEL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
MBD3L family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C159(1.42) | LDD3423 | [1] | |
Competitor(s) Related to This Target

