Details of the Target
General Information of Target
| Target ID | LDTP18657 | |||||
|---|---|---|---|---|---|---|
| Target Name | Uncharacterized protein C11orf97 (C11orf97) | |||||
| Gene Name | C11orf97 | |||||
| Gene ID | 643037 | |||||
| Synonyms |
Uncharacterized protein C11orf97 |
|||||
| 3D Structure | ||||||
| Sequence |
MRLFSGMNNQYTRREVFCRNTCHDLKHFWEREIGKQTYYRESEERRLGRSALRKLREEWK
QRLETKLRLRNNPEDTEKRTNVG |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton, cilium basal body
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_5 Probe Info |
![]() |
C55(0.87) | LDD2227 | [1] | |
Competitor(s) Related to This Target

