Details of the Target
General Information of Target
| Target ID | LDTP18607 | |||||
|---|---|---|---|---|---|---|
| Target Name | Notch homolog 2 N-terminal-like protein R (NOTCH2NLR) | |||||
| Gene Name | NOTCH2NLR | |||||
| Synonyms |
Notch homolog 2 N-terminal-like protein R; NOTCH2NL-related |
|||||
| 3D Structure | ||||||
| Sequence |
MRVLFFVFGVLSLMSTVPPTRSFTSNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLK
IIQIDGQKKW |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
NOTCH family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_4 Probe Info |
![]() |
C101(0.00); C90(0.00) | LDD2226 | [1] | |

