Details of the Target
General Information of Target
| Target ID | LDTP18560 | |||||
|---|---|---|---|---|---|---|
| Target Name | Oxidative stress-induced growth inhibitor 2 (OSGIN2) | |||||
| Gene Name | OSGIN2 | |||||
| Gene ID | 734 | |||||
| Synonyms |
C8orf1; Oxidative stress-induced growth inhibitor 2; hT41 |
|||||
| 3D Structure | ||||||
| Sequence |
MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTEMQRILSQPTFTEHLLRAVCTKLANM
YSTSTDCREHCRRGMKAKQLKAEAGRSCQRKGVPIQTPREHSWISCKKEFEANP |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
OKL38 family
|
|||||
| Function | May be involved in meiosis or the maturation of germ cells. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C483(1.83) | LDD3373 | [1] | |
Competitor(s) Related to This Target