Details of the Target
General Information of Target
| Target ID | LDTP18468 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cerebral cavernous malformations 2 protein-like (CCM2L) | |||||
| Gene Name | CCM2L | |||||
| Gene ID | 140706 | |||||
| Synonyms |
C20orf160; Cerebral cavernous malformations 2 protein-like; CCM2-like |
|||||
| 3D Structure | ||||||
| Sequence |
MAASRLPPATLTLKQFVRRQQVLLLYRRILQTIRQVPNDSDRKYLKDWAREEFRRNKSAT
EEDTIRMMITQGNMQLKELEKTLALAKS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CCM2 family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C117(1.89) | LDD3478 | [1] | |
Competitor(s) Related to This Target

