Details of the Target
General Information of Target
| Target ID | LDTP18458 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein 331 (ZNF331) | |||||
| Gene Name | ZNF331 | |||||
| Gene ID | 55422 | |||||
| Synonyms |
RITA; ZNF361; ZNF463; Zinc finger protein 331; C2H2-like zinc finger protein rearranged in thyroid adenomas; Zinc finger protein 361; Zinc finger protein 463 |
|||||
| 3D Structure | ||||||
| Sequence |
MAENAAPGLISELKLAVPWGHIAAKAWGSLQGPPVLCLHGWLDNASSFDRLIPLLPQDFY
YVAMDFGGHGLSSHYSPGVPYYLQTFVSEIRRVVAALKWNRFSILGHSFGGVVGGMFFCT FPEMVDKLILLDTPLFLLESDEMENLLTYKRRAIEHVLQVEASQEPSHVFSLKQLLQRQR TALTSSAGSCVRIPSGSCRPMSC |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May be involved in transcriptional regulation. May play a role in spermatogenesis. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C448(0.95) | LDD3312 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0165 | [2] | |
|
IPM Probe Info |
![]() |
C366(0.00); C282(0.00) | LDD0147 | [3] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [4] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [5] | |
|
HHS-465 Probe Info |
![]() |
K353(0.00); K356(0.00); Y355(0.00) | LDD2240 | [6] | |
Competitor(s) Related to This Target
References






