Details of the Target
General Information of Target
Target ID | LDTP18434 | |||||
---|---|---|---|---|---|---|
Target Name | Placenta-specific protein 1 (PLAC1) | |||||
Gene Name | PLAC1 | |||||
Gene ID | 10761 | |||||
Synonyms |
Placenta-specific protein 1 |
|||||
3D Structure | ||||||
Sequence |
MPSPVDASSADGGSGLGSHRRKRTTFSKGQLLELERAFAAWPYPNISTHEHLAWVTCLPE
AKVQVWFQKRWAKIIKNRKSGILSPGSECPQSSCSLPDTLQQPWDPQMPGQPPPSSGTPQ RTSVCRHSSCPAPGLSPRQGWEGAKAVAPWGSAGASEVHPSLERATPQTSLGSLSDLIYA LAIVVNVDHS |
|||||
Target Type |
Literature-reported
|
|||||
Target Bioclass |
Other
|
|||||
Family |
PLAC1 family
|
|||||
Subcellular location |
Secreted
|
|||||
Function | May play a role in placental development. | |||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IA-alkyne Probe Info |
![]() |
C80(0.29) | LDD2182 | [1] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0625 | F8 | Ramos | C80(1.07) | LDD2187 | [1] |
LDCM0572 | Fragment10 | Ramos | C80(0.28) | LDD2189 | [1] |
LDCM0573 | Fragment11 | Ramos | C80(0.33) | LDD2190 | [1] |
LDCM0574 | Fragment12 | Ramos | C80(0.58) | LDD2191 | [1] |
LDCM0575 | Fragment13 | Ramos | C80(0.56) | LDD2192 | [1] |
LDCM0576 | Fragment14 | Ramos | C80(2.85) | LDD2193 | [1] |
LDCM0579 | Fragment20 | Ramos | C80(0.29) | LDD2194 | [1] |
LDCM0582 | Fragment23 | Ramos | C80(0.83) | LDD2196 | [1] |
LDCM0578 | Fragment27 | Ramos | C80(0.76) | LDD2197 | [1] |
LDCM0586 | Fragment28 | Ramos | C80(0.59) | LDD2198 | [1] |
LDCM0588 | Fragment30 | Ramos | C80(1.64) | LDD2199 | [1] |
LDCM0590 | Fragment32 | Ramos | C80(0.76) | LDD2201 | [1] |
LDCM0468 | Fragment33 | Ramos | C80(0.87) | LDD2202 | [1] |
LDCM0566 | Fragment4 | Ramos | C80(0.90) | LDD2184 | [1] |
LDCM0610 | Fragment52 | Ramos | C80(0.51) | LDD2204 | [1] |
LDCM0614 | Fragment56 | Ramos | C80(0.52) | LDD2205 | [1] |
LDCM0569 | Fragment7 | Ramos | C80(1.08) | LDD2186 | [1] |
LDCM0571 | Fragment9 | Ramos | C80(0.72) | LDD2188 | [1] |
LDCM0022 | KB02 | Ramos | C80(0.29) | LDD2182 | [1] |
LDCM0023 | KB03 | Ramos | C80(1.05) | LDD2183 | [1] |
LDCM0024 | KB05 | Ramos | C80(0.60) | LDD2185 | [1] |