Details of the Target
General Information of Target
| Target ID | LDTP18358 | |||||
|---|---|---|---|---|---|---|
| Target Name | DNA-directed RNA polymerase II subunit RPB11-b1 (POLR2J2) | |||||
| Gene Name | POLR2J2 | |||||
| Gene ID | 246721 | |||||
| Synonyms |
DNA-directed RNA polymerase II subunit RPB11-b1; RNA polymerase II subunit B11-b1; RPB11b1; DNA-directed RNA polymerase II subunit J2 |
|||||
| 3D Structure | ||||||
| Sequence |
MEIVSTGNETITEFVLLGFYDIPELHFLFFIVFTAVYVFIIIGNMLIIVAVVSSQRLHKP
MYIFLANLSFLDILYTSAVMPKMLEGFLQEATISVAGCLLQFFIFGSLATAECLLLAVMA YDRYLAICYPLHYPLLMGPRRYMGLVVTTWLSGFVVDGLVVALVAQLRFCGPNHIDQFYC DFMLFVGLACSDPRVAQVTTLILSVFCLTIPFGLILTSYARIVVAVLRVPAGASRRRAFS TCSSHLAVVTTFYGTLMIFYVAPSAVHSQLLSKVFSLLYTVVTPLFNPVIYTMRNKEVHQ ALRKILCIKQTETLD |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Archaeal Rpo11/eukaryotic RPB11/RPC19 RNA polymerase subunit family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C31(1.84) | LDD3345 | [1] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0177 | [3] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [2] | |
Competitor(s) Related to This Target
References




