Details of the Target
General Information of Target
| Target ID | LDTP18346 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transmembrane 6 superfamily member 1 (TM6SF1) | |||||
| Gene Name | TM6SF1 | |||||
| Gene ID | 53346 | |||||
| Synonyms |
Transmembrane 6 superfamily member 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MPGEATETVPAIEQQLLQPQAETGSGTESDSDESVPELEEQDSTQVTAQVQLVVAAEIDE
EPVSKAKQRRSEKKARKARFKLGLQQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYM VFGEAKIEDLSQEAQLAAAEKFKVQGEAVSNIQENTQTPTVQEGSEDEEVDETGVEIKDI ELVLSQANVWGAKAVRALKNSNDIVNAIMELTM |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
TM6SF family
|
|||||
| Subcellular location |
Lysosome membrane
|
|||||
| Function | May function as sterol isomerase. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0161 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Fibroblast growth factor receptor 3 (FGFR3) | Tyr protein kinase family | P22607 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Gelsolin (GSN) | Villin/gelsolin family | P06396 | |||

