Details of the Target
General Information of Target
| Target ID | LDTP18343 | |||||
|---|---|---|---|---|---|---|
| Target Name | Keratin-associated protein 2-1 (KRTAP2-1) | |||||
| Gene Name | KRTAP2-1 | |||||
| Gene ID | 728279 | |||||
| Synonyms |
KAP2.1; KRTAP2.1A; KRTAP2.1B; Keratin-associated protein 2-1; High sulfur keratin-associated protein 2.1; Keratin-associated protein 2.1 |
|||||
| 3D Structure | ||||||
| Sequence |
MTGSCCGSTFSSLSYGGGCCQPCCCRDPCCCRPVTCQTTVCRPVTCVPRCTRPICEPCRR
PVCCDPCSLQEGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPCGQPTPCSTTCRT SSC |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
KRTAP type 2 family
|
|||||
| Function |
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C268(0.00); C203(0.00) | LDD0161 | [1] | |