Details of the Target
General Information of Target
| Target ID | LDTP18340 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein maestro (MRO) | |||||
| Gene Name | MRO | |||||
| Gene ID | 83876 | |||||
| Synonyms |
B29; C18orf3; Protein maestro; Male-specific transcription in the developing reproductive organs; Protein B29 |
|||||
| 3D Structure | ||||||
| Sequence |
MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQP
YPPCQQKYPPKSK |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus, nucleolus
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K37(4.88) | LDD0277 | [1] | |