Details of the Target
General Information of Target
| Target ID | LDTP18305 | |||||
|---|---|---|---|---|---|---|
| Target Name | Proteasome assembly chaperone 3 (PSMG3) | |||||
| Gene Name | PSMG3 | |||||
| Gene ID | 84262 | |||||
| Synonyms |
C7orf48; PAC3; Proteasome assembly chaperone 3; PAC-3; hPAC3 |
|||||
| 3D Structure | ||||||
| Sequence |
MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQ
PFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
PSMG3 family
|
|||||
| Function | Chaperone protein which promotes assembly of the 20S proteasome. May cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
 |
13.60 | LDD0403 | [1] | |
|
1c-yne Probe Info |
 |
N.A. | LDD0228 | [2] | |
|
AOyne Probe Info |
 |
15.00 | LDD0443 | [3] | |
Competitor(s) Related to This Target
References