Details of the Target
General Information of Target
| Target ID | LDTP18295 | |||||
|---|---|---|---|---|---|---|
| Target Name | Osteoclast stimulatory transmembrane protein (OCSTAMP) | |||||
| Gene Name | OCSTAMP | |||||
| Gene ID | 128506 | |||||
| Synonyms |
C20orf123; Osteoclast stimulatory transmembrane protein; OC-STAMP |
|||||
| 3D Structure | ||||||
| Sequence |
MSYFRTPQTHPGPLPSGQGGAASPGLSLGLCSPVEPVVVASGGTGPLSQKAEQVAPAAQA
WGPALAMPQARGCPGGTSWETLRKEYSRNCHKFPHVRQLESLGWDNGYSRSRAPDLGGPS RPRPLMLCGLSPRVLPVPSEAVGKEASSQPDICILTLAMMIAGIPTVPVPGVREEDLIWA AQAFMMAHPEPEGAVEGARWEQAHAHTASGKMPLVRSKRGQPPGSCL |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function |
Probable cell surface receptor that plays a role in cellular fusion and cell differentiation. Cooperates with DCSTAMP in modulating cell-cell fusion in both osteoclasts and foreign body giant cells (FBGCs). Involved in osteoclast bone resorption. Promotes osteoclast differentiation and may play a role in the multinucleated osteoclast maturation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C192(0.00); C25(0.00); C345(0.00) | LDD0161 | [1] | |

