Details of the Target
General Information of Target
| Target ID | LDTP18289 | |||||
|---|---|---|---|---|---|---|
| Target Name | LBH domain-containing protein 1 (LBHD1) | |||||
| Gene Name | LBHD1 | |||||
| Gene ID | 79081 | |||||
| Synonyms |
C11orf48; LBH domain-containing protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSA
KFPIGRRDFDTLRCMLGRVYQRCWQV |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C1031(0.00); C305(0.00); C1009(0.00) | LDD0161 | [1] | |
The Interaction Atlas With This Target

