Details of the Target
General Information of Target
| Target ID | LDTP18275 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative protocadherin beta-18 (PCDHB18P) | |||||
| Gene Name | PCDHB18P | |||||
| Synonyms |
PCDHB18; Putative protocadherin beta-18; PCDH-beta-18; PCDH-psi2 |
|||||
| 3D Structure | ||||||
| Sequence |
MKEPGPNFVTVRKGLHSFKMAFVKHLLLFLSPRLECSGSITDHCSLHLPVQEILMSQPPE
QLGLQTNLGNQESSGMMKLFMPRPKVLAQYESIQFMP |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | Potential calcium-dependent cell-adhesion protein. | |||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0161 | [1] | |

