Details of the Target
General Information of Target
| Target ID | LDTP18269 | |||||
|---|---|---|---|---|---|---|
| Target Name | Serine incorporator 2 (SERINC2) | |||||
| Gene Name | SERINC2 | |||||
| Gene ID | 347735 | |||||
| Synonyms |
TDE2L; Serine incorporator 2; Tumor differentially expressed protein 2-like |
|||||
| 3D Structure | ||||||
| Sequence |
MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIE
DDRIDDVLKGMGEKPPSGV |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
TDE1 family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| CCK81 | SNV: p.T144A | . | |||
| Ishikawa (Heraklio) 02 ER | SNV: p.Y314N | . | |||
| NCIH1155 | SNV: p.A253T | . | |||
| NCIH661 | SNV: p.Q64H | IA-alkyne Probe Info | |||
| RKO | SNV: p.G84D | . | |||
| RVH421 | SNV: p.W283L | . | |||
| SKNSH | SNV: p.L91M | . | |||
| SNGM | SNV: p.E194Ter | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C205(1.62) | LDD3410 | [1] | |
|
IA-alkyne Probe Info |
![]() |
C455(0.00); C385(0.00) | LDD0161 | [2] | |
Competitor(s) Related to This Target
References


