Details of the Target
General Information of Target
| Target ID | LDTP18263 | |||||
|---|---|---|---|---|---|---|
| Target Name | Potassium voltage-gated channel subfamily A member 7 (KCNA7) | |||||
| Gene Name | KCNA7 | |||||
| Gene ID | 3743 | |||||
| Synonyms |
Potassium voltage-gated channel subfamily A member 7; Voltage-gated potassium channel subunit Kv1.7 |
|||||
| 3D Structure | ||||||
| Sequence |
MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPS
PPCQPKCPPKSK |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.7/KCNA7 sub-subfamily
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function |
Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C256(0.00); C706(0.00); C509(0.00); C190(0.00) | LDD0161 | [1] | |
The Interaction Atlas With This Target