Details of the Target
General Information of Target
| Target ID | LDTP18242 | |||||
|---|---|---|---|---|---|---|
| Target Name | Pannexin-3 (PANX3) | |||||
| Gene Name | PANX3 | |||||
| Gene ID | 116337 | |||||
| Synonyms |
Pannexin-3 |
|||||
| 3D Structure | ||||||
| Sequence |
MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAW
MVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVD |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Pannexin family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Regulator of osteoblast differentiation by functionning as a Ca(2+) channel in the endoplasmic reticulum which regulates calmodulin (CaM) pathways. Allows ATP release into the extracellular space and activation or purinergic receptors.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K163(2.44) | LDD0277 | [1] | |