Details of the Target
General Information of Target
| Target ID | LDTP18235 | |||||
|---|---|---|---|---|---|---|
| Target Name | Double homeobox protein 5 (DUX5) | |||||
| Gene Name | DUX5 | |||||
| Gene ID | 26581 | |||||
| Synonyms |
Double homeobox protein 5 |
|||||
| 3D Structure | ||||||
| Sequence |
MSSQQQQRQQQQCPPQRAQQQQVKQPCQPPPVKCQETCAPKTKDPCAPQVKKQCPPKGTI
IPAQQKCPSAQQASKSKQK |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Paired homeobox family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
N.A. | LDD0161 | [1] | |