Details of the Target
General Information of Target
| Target ID | LDTP18144 | |||||
|---|---|---|---|---|---|---|
| Target Name | Polyadenylate-binding protein 5 (PABPC5) |
|
||||
| Gene Name | PABPC5 | |||||
| Gene ID | 140886 | |||||
| Synonyms |
PABP5; Polyadenylate-binding protein 5; PABP-5; Poly(A)-binding protein 5 |
|||||
| 3D Structure | ||||||
| Sequence |
MTSQPISNETIIMLPSNVINFSQAEKPEPTNQGQDSLKKRLQAKVKVIGVHSSLAGSILS
ALSALVGFILLSVNPAALNPASLQCKLDEKDIPTRLLLSYDYHSPYTMDCHRAKASLAGT LSLMLVSTVLEFCLAVLTAVLQWKQTV |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm; Mitochondrion matrix
|
|||||
| Function | Binds the poly(A) tail of mRNA. May be involved in cytoplasmic regulatory processes of mRNA metabolism. Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
N.A. | LDD0161 | [1] | |
|
HHS-465 Probe Info |
 |
N.A. | LDD2240 | [2] | |
The Interaction Atlas With This Target
References