Details of the Target
General Information of Target
| Target ID | LDTP18127 | |||||
|---|---|---|---|---|---|---|
| Target Name | Engulfment and cell motility protein 3 (ELMO3) | |||||
| Gene Name | ELMO3 | |||||
| Gene ID | 79767 | |||||
| Synonyms |
Engulfment and cell motility protein 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MMATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQE
DAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in association with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Probe 1 Probe Info |
![]() |
Y304(9.43) | LDD3495 | [1] | |
|
DBIA Probe Info |
![]() |
C597(1.18) | LDD3310 | [2] | |
|
IA-alkyne Probe Info |
![]() |
C544(0.00); C76(0.00) | LDD0162 | [3] | |
|
NAIA_5 Probe Info |
![]() |
C608(0.00); C38(0.00) | LDD2223 | [4] | |
Competitor(s) Related to This Target
References




