Details of the Target
General Information of Target
| Target ID | LDTP18095 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger CCHC domain-containing protein 13 (ZCCHC13) | |||||
| Gene Name | ZCCHC13 | |||||
| Gene ID | 389874 | |||||
| Synonyms |
Zinc finger CCHC domain-containing protein 13 |
|||||
| 3D Structure | ||||||
| Sequence |
MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVP
RAEISHHISSCDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFV WGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYVLPWKNNGNAQ |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
![]() |
N.A. | LDD0223 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase SIAH1 (SIAH1) | SINA (Seven in absentia) family | Q8IUQ4 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Zinc finger protein 648 (ZNF648) | Krueppel C2H2-type zinc-finger protein family | Q5T619 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| U1 small nuclear ribonucleoprotein A (SNRPA) | RRM U1 A/B'' family | P09012 | |||

