Details of the Target
General Information of Target
| Target ID | LDTP18090 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein phosphatase 1 regulatory subunit 1C (PPP1R1C) | |||||
| Gene Name | PPP1R1C | |||||
| Gene ID | 151242 | |||||
| Synonyms |
Protein phosphatase 1 regulatory subunit 1C; Inhibitor-5 of protein phosphatase 1; IPP5 |
|||||
| 3D Structure | ||||||
| Sequence |
MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKR
RGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWR QWHYDGLHPSYLYNRHHT |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein phosphatase inhibitor 1 family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function | May increase cell susceptibility to TNF-induced apoptosis. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0161 | [1] | |
The Interaction Atlas With This Target

