Details of the Target
General Information of Target
| Target ID | LDTP18069 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein 721 (ZNF721) | |||||
| Gene Name | ZNF721 | |||||
| Gene ID | 170960 | |||||
| Synonyms |
KIAA1982; Zinc finger protein 721 |
|||||
| 3D Structure | ||||||
| Sequence |
MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ
IGIEWNLSPVGRVTPKEWKHQ |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May be involved in transcriptional regulation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C42(2.27) | LDD3376 | [1] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [2] | |
|
HHS-465 Probe Info |
![]() |
K151(0.00); K154(0.00); Y153(0.00) | LDD2240 | [3] | |
Competitor(s) Related to This Target
References



