Details of the Target
General Information of Target
| Target ID | LDTP18042 | |||||
|---|---|---|---|---|---|---|
| Target Name | Checkpoint protein HUS1B (HUS1B) | |||||
| Gene Name | HUS1B | |||||
| Gene ID | 135458 | |||||
| Synonyms |
Checkpoint protein HUS1B; hHUS1B |
|||||
| 3D Structure | ||||||
| Sequence |
MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAY
PQIEDMARTFFAHFPLGSTLGFHVPYQED |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
HUS1 family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C1111(0.00); C931(0.00) | LDD0161 | [1] | |