Details of the Target
General Information of Target
| Target ID | LDTP17818 | |||||
|---|---|---|---|---|---|---|
| Target Name | Neuropeptide B (NPB) | |||||
| Gene Name | NPB | |||||
| Gene ID | 256933 | |||||
| Synonyms |
PPL7; PPNPB; Neuropeptide B; Preproprotein L7; hPPL7) [Cleaved into: Neuropeptide B-23; NPB23; hL7; Neuropeptide B-29; NPB29; hL7C)] |
|||||
| 3D Structure | ||||||
| Sequence |
MALIRKTFYFLFAMFFILVQLPSGCQAGLDFSQPFPSGEFAVCESCKLGRGKCRKECLEN
EKPDGNCRLNFLCCRQRI |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Neuropeptide B/W family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function | May be involved in the regulation of feeding, neuroendocrine system, memory, learning and in the afferent pain pathway. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
N.A. | LDD0161 | [1] | |