Details of the Target
General Information of Target
| Target ID | LDTP17733 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transmembrane and coiled-coil domain-containing protein 5A (TMCO5A) | |||||
| Gene Name | TMCO5A | |||||
| Gene ID | 145942 | |||||
| Synonyms |
TMCO5; Transmembrane and coiled-coil domain-containing protein 5A |
|||||
| 3D Structure | ||||||
| Sequence |
MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAW
NLKKGLSTEDATSAYISKAKELIEKYGI |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
TMCO5 family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0161 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Transmembrane protein 60 (TMEM60) | . | Q9H2L4 | |||
Other

