Details of the Target | Chem(Pro)²

General Information of Target

Target ID	LDTP17727
Target Name	Probable inactive allantoicase (ALLC)
Gene Name	ALLC
Gene ID	55821
Synonyms	Probable inactive allantoicase; Allantoate amidinohydrolase
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MRTQVYEGLCKNYFSLAVLQRDRIKLLFFDILVFLSVFLLFLLFLVDIMANNTTSLGSPW PENFWEDLIMSFTVSMAIGLVLGGFIWAVFICLSRRRRASAPISQWSSSRRSRSSYTHGL NRTGFYRHSGCERRSNLSLASLTFQRQASLEQANSFPRKSSFRASTFHPFLQCPPLPVET ESQLVTLPSSNISPTISTSHSLSRPDYWSSNSLRVGLSTPPPPAYESIIKAFPDS
Target Bioclass	Enzyme
Family	Allantoicase family
Function	The function of this enzyme is unclear as allantoicase activity is not known to exist in mammals.
Uniprot ID	Q8N6M5
Ensemble ID	ENST00000252505.4
HGNC ID	HGNC:17377

Target Site Mutations in Different Cell Lines

Cell line	Mutation details			Probe for labeling this protein in this cell
CASKI	SNV: p.C295F			.
HT115	SNV: p.D355N			.
IPC298	SNV: p.E50K			.
MDST8	SNV: p.S129F			.
MM1S	SNV: p.W49Ter			.
NCIH446	SNV: p.R376L			.
SW1271	SNV: p.E250K			.

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 1 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
Acrolein Probe Info			N.A.	LDD0222	[1]

Competitor(s) Related to This Target

Competitor ID	Name	Cell line	Binding Site(Ratio)	Interaction ID	Ref
LDCM0108	Chloroacetamide	HeLa	N.A.	LDD0222	[1]

References

1	ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.