Details of the Target
General Information of Target
| Target ID | LDTP17726 | |||||
|---|---|---|---|---|---|---|
| Target Name | Myc target protein 1 (MYCT1) | |||||
| Gene Name | MYCT1 | |||||
| Gene ID | 80177 | |||||
| Synonyms |
MTLC; MTMC1; Myc target protein 1; Myc target in myeloid cells protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MKLLLLTLTVLLLLSQLTPGGTQRCWNLYGKCRYRCSKKERVYVYCINNKMCCVKPKYQP
KERWWPF |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
MYCT1 family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
May regulate certain MYC target genes, MYC seems to be a direct upstream transcriptional activator. Does not seem to significantly affect growth cell capacity. Overexpression seems to mediate many of the known phenotypic features associated with MYC, including promotion of apoptosis, alteration of morphology, enhancement of anchorage-independent growth, tumorigenic conversion, promotion of genomic instability, and inhibition of hematopoietic differentiation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C131(1.14) | LDD3388 | [1] | |
Competitor(s) Related to This Target