Details of the Target
General Information of Target
| Target ID | LDTP17584 | |||||
|---|---|---|---|---|---|---|
| Target Name | Leucine-rich repeat transmembrane neuronal protein 4 (LRRTM4) | |||||
| Gene Name | LRRTM4 | |||||
| Gene ID | 80059 | |||||
| Synonyms |
Leucine-rich repeat transmembrane neuronal protein 4 |
|||||
| 3D Structure | ||||||
| Sequence |
MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSS
ENIFTSAKVTHKNEADDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSED LLLLPGEVEQDVSTSIPSCIPFVAQPPTCEVKPKPSVKRMDKQTEEILGDEVQLFSLDEE FDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
LRRTM family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | May play a role in the development and maintenance of the vertebrate nervous system. Exhibits strong synaptogenic activity, restricted to excitatory presynaptic differentiation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0161 | [1] | |

