Details of the Target
General Information of Target
| Target ID | LDTP17572 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein 605 (ZNF605) | |||||
| Gene Name | ZNF605 | |||||
| Gene ID | 100289635 | |||||
| Synonyms |
Zinc finger protein 605 |
|||||
| 3D Structure | ||||||
| Sequence |
MSNTTVPNAPQANSDSMVGYVLGPFFLITLVGVVVAVVMYVQKKKRVDRLRHHLLPMYSY
DPAEELHEAEQELLSDMGDPKVVHGWQSGYQHKRMPLLDVKT |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May be involved in transcriptional regulation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
CY-1 Probe Info |
![]() |
C507(0.00); C510(0.00); E509(0.00); R511(0.00) | LDD0246 | [1] | |
|
N1 Probe Info |
![]() |
N.A. | LDD0245 | [1] | |
|
DBIA Probe Info |
![]() |
C104(0.24) | LDD2236 | [2] | |
References



