Details of the Target
General Information of Target
| Target ID | LDTP17569 | |||||
|---|---|---|---|---|---|---|
| Target Name | Mas-related G-protein coupled receptor member G (MRGPRG) | |||||
| Gene Name | MRGPRG | |||||
| Gene ID | 386746 | |||||
| Synonyms |
GPR169; MRGG; Mas-related G-protein coupled receptor member G; G-protein coupled receptor 169 |
|||||
| 3D Structure | ||||||
| Sequence |
MVAPAARVFLRAVRAALTSTVPDLLCLLARGSPRGLASGRLPLAVHSAQHGPGSGAPWLR
IARRALRFVLSKHWGDDCYLTNRLWQDLKPPSHVENGQELRLAPPVQWALQVQGNQLQTA VLCLRMAPPEPAGSRQRI |
|||||
| Target Bioclass |
GPCR
|
|||||
| Family |
G-protein coupled receptor 1 family, Mas subfamily
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | Orphan receptor. May regulate nociceptor function and/or development, including the sensation or modulation of pain. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Phosphinate-6 Probe Info |
 |
N.A. | LDD0018 | [1] | |