Details of the Target
General Information of Target
Target ID | LDTP17567 | |||||
---|---|---|---|---|---|---|
Target Name | Zinc finger protein 467 (ZNF467) | |||||
Gene Name | ZNF467 | |||||
Gene ID | 168544 | |||||
Synonyms |
Zinc finger protein 467 |
|||||
3D Structure | ||||||
Sequence |
MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSAL
KECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM |
|||||
Target Bioclass |
Transcription factor
|
|||||
Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Transcription factor that promotes adipocyte differentiation and suppresses osteoblast differentiation in the bone marrow. Enhances the osteoclast-supporting ability of stromal cells. Binds with STAT3 the consensus sequence 5'-CTTCTGGGAAGA-3' of the acute phase response element (APRE). Transactivates several promoters including FOS, OSM and PPARG. Recruits a histone deacetylase complex.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C375(1.74) | LDD3343 | [1] | |
NAIA_5 Probe Info |
![]() |
C49(0.78) | LDD2227 | [2] |
Competitor(s) Related to This Target
References