Details of the Target
General Information of Target
| Target ID | LDTP17528 | |||||
|---|---|---|---|---|---|---|
| Target Name | Monocarboxylate transporter 14 (SLC16A14) | |||||
| Gene Name | SLC16A14 | |||||
| Gene ID | 151473 | |||||
| Synonyms |
MCT14; Monocarboxylate transporter 14; MCT 14; Solute carrier family 16 member 14 |
|||||
| 3D Structure | ||||||
| Sequence |
MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVV
VFVRHFLCYICKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVD PEREIYKRLGMKRGEEIASSGQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTL ILGPGNNIHFIHRDRNRLDHKPINSVLQLVGVQHVNFTNRPSVIHV |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Major facilitator superfamily, Monocarboxylate porter (TC 2.A.1.13) family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | Proton-linked monocarboxylate transporter. May catalyze the transport of monocarboxylates across the plasma membrane. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [1] | |

