Details of the Target
General Information of Target
| Target ID | LDTP17424 | |||||
|---|---|---|---|---|---|---|
| Target Name | Beta-galactosidase-1-like protein (GLB1L) | |||||
| Gene Name | GLB1L | |||||
| Gene ID | 79411 | |||||
| Synonyms |
Beta-galactosidase-1-like protein; EC 3.2.1.- |
|||||
| 3D Structure | ||||||
| Sequence |
MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKA
PPPQKPSHEGSYLLQP |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Glycosyl hydrolase 35 family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function | Probable glycosyl hydrolase. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C62(3.24) | LDD3430 | [1] | |
Competitor(s) Related to This Target

