Details of the Target
General Information of Target
| Target ID | LDTP17353 | |||||
|---|---|---|---|---|---|---|
| Target Name | Calpain-13 (CAPN13) | |||||
| Gene Name | CAPN13 | |||||
| Gene ID | 92291 | |||||
| Synonyms |
Calpain-13; EC 3.4.22.-; Calcium-activated neutral proteinase 13; CANP 13 |
|||||
| 3D Structure | ||||||
| Sequence |
MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCY
FTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNRHFWMFHSQAVYDINRLDSTGV NVLLRGNLPEIEESTDEDVLNISAEECIR |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Peptidase C2 family
|
|||||
| Function | Probable non-lysosomal thiol-protease. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C297(4.33) | LDD2268 | [1] | |
Competitor(s) Related to This Target

