Details of the Target
General Information of Target
| Target ID | LDTP17195 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein 484 (ZNF484) | |||||
| Gene Name | ZNF484 | |||||
| Gene ID | 83744 | |||||
| Synonyms |
Zinc finger protein 484 |
|||||
| 3D Structure | ||||||
| Sequence |
MSGHQRTRSRSRERRDDQDSNHPVGAVVAQELPSNDQLQQEEPPIESQDYTPGQERDEGA
LDFQVLGLAAYLWELTRSKTGGERGDGPNVKGEFLPNLEPVKIPEAGEGQPSV |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May be involved in transcriptional regulation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
HHS-465 Probe Info |
![]() |
K522(0.00); K525(0.00); Y524(0.00) | LDD2240 | [1] | |

