Details of the Target
General Information of Target
| Target ID | LDTP17145 | |||||
|---|---|---|---|---|---|---|
| Target Name | Raftlin-2 (RFTN2) | |||||
| Gene Name | RFTN2 | |||||
| Gene ID | 130132 | |||||
| Synonyms |
C2orf11; Raftlin-2; Raft-linking protein 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MGWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAE
IERDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILEKPKK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Raftlin family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Upon bacterial lipopolysaccharide stimulation, mediates clathrin-dependent internalization of TLR4 in dendritic cells, resulting in activation of TICAM1-mediated signaling and subsequent IFNB1 production. May regulate B-cell antigen receptor-mediated signaling.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C128(2.13) | LDD3424 | [1] | |
|
CY-1 Probe Info |
 |
N.A. | LDD0246 | [2] | |
|
IA-alkyne Probe Info |
 |
C52(0.00); C63(0.00) | LDD0161 | [3] | |
Competitor(s) Related to This Target
References