Details of the Target
General Information of Target
Target ID | LDTP17138 | |||||
---|---|---|---|---|---|---|
Target Name | Zinc-regulated GTPase metalloprotein activator 1F (ZNG1F) | |||||
Gene Name | ZNG1F | |||||
Gene ID | 644019 | |||||
Synonyms |
CBWD6; CBWD7; Zinc-regulated GTPase metalloprotein activator 1F; EC 3.6.5.-; Cobalamin synthase W domain-containing protein 6; COBW domain-containing protein 6 |
|||||
3D Structure | ||||||
Sequence |
MGKCSGRCTLVAFCCLQLVAALERQIFDFLGYQWAPILANFLHIMAVILGIFGTVQYRSR
YLILYAAWLVLWVGWNAFIICFYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPV LNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDF IGGFDSYGYQAPQKTSHLQLQPLYTSG |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
SIMIBI class G3E GTPase family, ZNG1 subfamily
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Zinc chaperone that directly transfers zinc cofactor to target metalloproteins, thereby activating them. Catalyzes zinc insertion into the active site of methionine aminopeptidase METAP1, which function to cleave the initiator methionine from polypeptides during or after protein translation. Mechanistically, the N-terminal psi-PxLVp motif binds to the C6H2-type zinc finger of inactive form of METAP1. After formation of the docked complex, zinc is transferred from the CXCC motif in the GTPase domain of ZNG1F to the zinc binding site in the peptidase domain of METAP1 in a process requiring GTP hydrolysis. GTP/GDP exchange is required for release of active METAP1.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [1] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD2241 | [1] | |
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [1] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [2] |
References