Details of the Target
General Information of Target
| Target ID | LDTP17103 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein SNAI3 (SNAI3) | |||||
| Gene Name | SNAI3 | |||||
| Gene ID | 333929 | |||||
| Synonyms |
ZNF293; Zinc finger protein SNAI3; Protein snail homolog 3; Zinc finger protein 293 |
|||||
| 3D Structure | ||||||
| Sequence |
MATLLAWVGVSCCELAEEDFLAVSPLDPRYREVHYVLLDPSCSGSGMPSRQLEDPGAGTP
SPVRLHALAGFQQRALCHALTFPSLQRLVYSMCSLCQEENEDMVPDALQQNPGAFRLAPA LPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPT |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Snail C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Seems to inhibit myoblast differentiation. Transcriptional repressor of E-box-dependent transactivation of downstream myogenic bHLHs genes. Binds preferentially to the canonical E-box sequences 5'-CAGGTG-3' and 5'-CACCTG-3'.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C239(0.00); C242(0.00) | LDD2241 | [1] | |

