Details of the Target
General Information of Target
| Target ID | LDTP17070 | |||||
|---|---|---|---|---|---|---|
| Target Name | UDP-N-acetylglucosamine transporter TMEM241 (TMEM241) | |||||
| Gene Name | TMEM241 | |||||
| Gene ID | 85019 | |||||
| Synonyms |
C18orf45; UDP-N-acetylglucosamine transporter TMEM241; Solute carrier family 35 member D4; Transmembrane protein 241 |
|||||
| 3D Structure | ||||||
| Sequence |
MALLLCLVCLTAALAHGCLHCHSNFSKKFSFYRHHVNFKSWWVGDIPVSGALLTDWSDDT
MKELHLAIPAKITREKLDQVATAVYQMMDQLYQGKMYFPGYFPNELRNIFREQVHLIQNA IIESRIDCQHRCGIFQYETISCNNCTDSHVACFGYNCESSAQWKSAVQGLLNYINNWHKQ DTSMRPRSSAFSWPGTHRATPAFLVSPALRCLEPPHLANLTLEDAAECLKQH |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
TMEM241 family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function |
Golgi-localized UDP-N-acetylglucosamine (UDP-GlcNAc) transporter that transports UDP-N-acetylglucosamine into Golgi lumen. Contributes to lysosomal targeting of NPC2, a key protein required for lysosomal cholesterol exiting, and that utilizes the mannose-6-phosphate (M6P) modification pathway for its lysosomal targeting.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0161 | [1] | |
The Interaction Atlas With This Target

