Details of the Target

General Information of Target

Target ID	LDTP17057
Target Name	Male-enhanced antigen 1 (MEA1)
Gene Name	MEA1
Gene ID	4201
Synonyms	MEA; Male-enhanced antigen 1; MEA-1
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MEHKEVVLLLLLFLKSAPTETGPSVQECYHSNGQSYRGTYFTTVTGRTCQAWSSMTPHQH SRTPEKYPNDGLISNYCRNPDCSAGPWCYTTDPNVRWEYCNLTRCSDDEGTVFVPLTVIP VPSLEDSFIQVA
Target Bioclass	Other
Function	May play an important role in spermatogenesis and/or testis development.
Uniprot ID	Q16626
Ensemble ID	ENST00000244711.4
HGNC ID	HGNC:6986

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 1 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
IA-alkyne Probe Info			C276(0.00); C159(0.00); C17(0.00); C455(0.00)	LDD0161	[1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transporter and channel

Click To Hide/Show 2 Protein(s) Interacting with This Target

Protein name				Family	Uniprot ID
AP-2 complex subunit beta (AP2B1)				Adaptor complexes large subunit family	P63010
AP-1 complex subunit mu-1 (AP1M1)				Adaptor complexes medium subunit family	Q9BXS5

References

1	SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18. Mass spectrometry data entry*: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060