Details of the Target
General Information of Target
| Target ID | LDTP17055 | |||||
|---|---|---|---|---|---|---|
| Target Name | T-cell acute lymphocytic leukemia protein 2 (TAL2) | |||||
| Gene Name | TAL2 | |||||
| Gene ID | 6887 | |||||
| Synonyms |
BHLHA19; T-cell acute lymphocytic leukemia protein 2; TAL-2; Class A basic helix-loop-helix protein 19; bHLHa19 |
|||||
| 3D Structure | ||||||
| Sequence |
MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKL
AYTVSRTGRQVLGERRQRAPN |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C277(0.00); C166(0.00) | LDD0161 | [1] | |
The Interaction Atlas With This Target

