Details of the Target
General Information of Target
Target ID | LDTP17055 | |||||
---|---|---|---|---|---|---|
Target Name | T-cell acute lymphocytic leukemia protein 2 (TAL2) | |||||
Gene Name | TAL2 | |||||
Gene ID | 6887 | |||||
Synonyms |
BHLHA19; T-cell acute lymphocytic leukemia protein 2; TAL-2; Class A basic helix-loop-helix protein 19; bHLHa19 |
|||||
3D Structure | ||||||
Sequence |
MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKL
AYTVSRTGRQVLGERRQRAPN |
|||||
Target Bioclass |
Transcription factor
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IA-alkyne Probe Info |
![]() |
C277(0.00); C166(0.00) | LDD0161 | [1] |
The Interaction Atlas With This Target