Details of the Target
General Information of Target
| Target ID | LDTP17033 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein CROC-4 (MIR9-1HG) | |||||
| Gene Name | MIR9-1HG | |||||
| Synonyms |
C1orf61; CROC4; Protein CROC-4; Contingent replication of cDNA 4; MIR9-1 host gene |
|||||
| 3D Structure | ||||||
| Sequence |
MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAID
ELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May play a role in FOS signaling pathways involved in development and remodeling of neurons. Promotes transcription of the FOS promoter. | |||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C12(0.00); C239(0.00); C303(0.00); C1113(0.00) | LDD0161 | [1] | |