Details of the Target
General Information of Target
Target ID | LDTP17031 | |||||
---|---|---|---|---|---|---|
Target Name | Zinc finger protein 154 (ZNF154) | |||||
Gene Name | ZNF154 | |||||
Gene ID | 7710 | |||||
Synonyms |
KIAA2003; Zinc finger protein 154 |
|||||
3D Structure | ||||||
Sequence |
MAARAVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALCFIF
|
|||||
Target Bioclass |
Transcription factor
|
|||||
Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function | May be involved in transcriptional regulation. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IA-alkyne Probe Info |
![]() |
C285(0.00); C459(0.00); C616(0.00); C50(0.00) | LDD0161 | [1] |