Details of the Target
General Information of Target
| Target ID | LDTP17030 | |||||
|---|---|---|---|---|---|---|
| Target Name | B melanoma antigen 1 (BAGE) | |||||
| Gene Name | BAGE | |||||
| Gene ID | 574 | |||||
| Synonyms |
BAGE1; B melanoma antigen 1; B melanoma antigen; Antigen MZ2-BA; Cancer/testis antigen 2.1; CT2.1 |
|||||
| 3D Structure | ||||||
| Sequence |
MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGE
DEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
BAGE family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function | Unknown. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. | |||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C1470(0.00); C1396(0.00) | LDD0161 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Histone acetyltransferase KAT5 (KAT5) | MYST (SAS/MOZ) family | Q92993 | |||
| Protein kinase C alpha type (PRKCA) | AGC Ser/Thr protein kinase family | P17252 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| 14-3-3 protein gamma (YWHAG) | 14-3-3 family | P61981 | |||

