Details of the Target
General Information of Target
| Target ID | LDTP17013 | |||||
|---|---|---|---|---|---|---|
| Target Name | Binder of sperm protein homolog 1 (BSPH1) | |||||
| Gene Name | BSPH1 | |||||
| Gene ID | 100131137 | |||||
| Synonyms |
Binder of sperm protein homolog 1; Bovine seminal plasma protein homolog 1; Bovine seminal plasma protein-like 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHL
TERGAGLLQPQPQGPVRTPGPPSGSHPAAADN |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Seminal plasma protein family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Binds sperm in vitro and promotes sperm capacitation. Specifically promotes capacitation induced by high density lipoproteins (HDLs). Also binds heparin, phospholipid liposomes, and weakly to gelatin. Does not bind chondroitin sulfate B.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C91(0.00); C455(0.00); C61(0.00); C148(0.00) | LDD0161 | [1] | |

