Details of the Target
General Information of Target
| Target ID | LDTP17002 | |||||
|---|---|---|---|---|---|---|
| Target Name | Alpha-ketoglutarate dehydrogenase component 4 (KGD4) | |||||
| Gene Name | KGD4 | |||||
| Gene ID | 92259 | |||||
| Synonyms |
MRPS36; Alpha-ketoglutarate dehydrogenase component 4; Alpha-ketoglutarate dehydrogenase subunit 4 |
|||||
| 3D Structure | ||||||
| Sequence |
MAARTAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTK
PVVTISDEPDILYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTL LQSVHIYKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQL PEHIKEPIWETLSEEKEESKS |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Mitochondrion
|
|||||
| Function |
Molecular adapter that is necessary to form a stable 2-oxoglutarate dehydrogenase enzyme complex (OGDHC). Enables the specific recruitment of E3 subunit to E2 subunit in the 2-oxoglutarate dehydrogenase complex (OGDHC).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K17(8.95); K57(9.68); K83(3.41) | LDD0277 | [1] | |
|
Probe 1 Probe Info |
![]() |
Y67(11.35) | LDD3495 | [2] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [3] | |
|
m-APA Probe Info |
![]() |
H48(0.00); H55(0.00) | LDD2231 | [3] | |
|
IA-alkyne Probe Info |
![]() |
C482(0.00); C159(0.00); C112(0.00); C330(0.00) | LDD0161 | [4] | |
|
1d-yne Probe Info |
![]() |
N.A. | LDD0357 | [5] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [6] | |
|
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [6] | |
Competitor(s) Related to This Target
References








