Details of the Target
General Information of Target
| Target ID | LDTP16999 | |||||
|---|---|---|---|---|---|---|
| Target Name | Endogenous retrovirus group K member 7 Pro protein (ERVK-7) | |||||
| Gene Name | ERVK-7 | |||||
| Synonyms |
Endogenous retrovirus group K member 7 Pro protein; HERV-K(III) Pro protein; HERV-K102 Pro protein; HERV-K_1q22 provirus ancestral Pro protein; EC 3.4.23.50; Protease; Proteinase; PR |
|||||
| 3D Structure | ||||||
| Sequence |
WASQVSENRPVCKAIIQGKQFEGLVDTGADVSIIALNQWPKNWPKQKAVTGLVGIGTASE
VYQSMEILHCLGPDNQESTVQPMITSIPLNLWGRDLLQQWGAEITMPAPLYSPTSQKIMT KRGYIPGKGLGKNEDGIKIPFEAKINQKREGIGYPF |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Peptidase A2 family, HERV class-II K(HML-2) subfamily
|
|||||
| Function |
Retroviral proteases have roles in processing of the primary translation products and the maturation of the viral particle. Endogenous Pro proteins may have kept, lost or modified their original function during evolution. This endogenous protein has retained most of the characteristics of retroviral proteases.
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C207(0.00); C240(0.00); C168(0.00); C286(0.00) | LDD0161 | [1] | |

